Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF570 Rabbit Polyclonal Antibody (Biotin)

ZNF570 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q96NI8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF570

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QGKAPWMVKRELTKGLCSGWEPICETEELTPKQDFYEEHQSQKIIETLTS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_653295

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methylene Tetrahydrofolate Dehydrogenase 2, CT (MTHFD2, Bifunctional Methylenetetrahydrofolate Dehydrogenase/cyclohydrolase Mitochondrial, NADP+ Dependent Methylenetetrahydrofolate Dehydrogenase 2 Methenyltetrahydrofolate Cyclohydrolase, NMDMC) (MaxLight 750) discontinued
M3410-01C-ML750 100 µL

Methylene Tetrahydrofolate Dehydrogenase 2, CT (MTHFD2, Bifunctional Methylenetetrahydrofolate Dehydrogenase/cyclohydrolase Mitochondrial, NADP+ Dependent Methylenetetrahydrofolate Dehydrogenase 2 Methenyltetrahydrofolate Cyclohydrolase, NMDMC) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Amt siRNA Oligos set (Mouse)
11854174 3x 5 nmol

Amt siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
SLA2 (Src-like-adapter 2, Src-like Adapter Protein 2, SLAP-2, Modulator of Antigen Receptor Signaling, MARS, C20orf156, SLAP2) (FITC)
MBS6149681-01 0.1 mL

SLA2 (Src-like-adapter 2, Src-like Adapter Protein 2, SLAP-2, Modulator of Antigen Receptor Signaling, MARS, C20orf156, SLAP2) (FITC)

Sign In for Pricing
View Details
SLA2 (Src-like-adapter 2, Src-like Adapter Protein 2, SLAP-2, Modulator of Antigen Receptor Signaling, MARS, C20orf156, SLAP2) (FITC)
MBS6149681-02 5x 0.1 mL

SLA2 (Src-like-adapter 2, Src-like Adapter Protein 2, SLAP-2, Modulator of Antigen Receptor Signaling, MARS, C20orf156, SLAP2) (FITC)

Sign In for Pricing
View Details
Mouse IGFBP-6 Recombinant Protein
PROTP47880-10ug 10 µg

Mouse IGFBP-6 Recombinant Protein

Sign In for Pricing
View Details
TAAR7E shRNA (m) Lentiviral Particles
sc-154036-V 200 µL

TAAR7E shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details