Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM15 Rabbit Polyclonal Antibody (FITC)

PRDM15 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PFM15, ZNF298, C21orf83

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PRDM15

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SILTVTFDTVSGSAMLHNRQNDVQIHPQPEASNPQSVAHFINLTTLVNSI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_658984

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SO1C1 rabbit pAb
E44H14987 100 µL

SO1C1 rabbit pAb

Sign In for Pricing
View Details
PLA2G4C (NM_001159322) Human Tagged Lenti ORF Clone
RC228444L3 10 µg

PLA2G4C (NM_001159322) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Angiopoietin 1 monoclonal antibody
orb1724850-01 50 µL

Angiopoietin 1 monoclonal antibody

Sign In for Pricing
View Details
Angiopoietin 1 monoclonal antibody
orb1724850-02 100 µL

Angiopoietin 1 monoclonal antibody

Sign In for Pricing
View Details
ADRB3 Rabbit Polyclonal Antibody
E53P10717 100 µL

ADRB3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
INCA1 siRNA (m)
sc-146234 10 µM

INCA1 siRNA (m)

Sign In for Pricing
View Details