Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM15 Rabbit Polyclonal Antibody (HRP)

PRDM15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PFM15, ZNF298, C21orf83

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PRDM15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SILTVTFDTVSGSAMLHNRQNDVQIHPQPEASNPQSVAHFINLTTLVNSI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_658984

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CO2 Incubator Water Jacketed BCWJ-8501
BCWJ-8501 1 Unit

CO2 Incubator Water Jacketed BCWJ-8501

Sign In for Pricing
View Details
1-Deoxygalactonojirimycin Hydrochloride
TRC-D236500-1MG 1 mg

1-Deoxygalactonojirimycin Hydrochloride

Sign In for Pricing
View Details
Recombinant BNIP1 Antibody
RC-15592-01 50 μL

Recombinant BNIP1 Antibody

Sign In for Pricing
View Details
Recombinant BNIP1 Antibody
RC-15592-02 100 µL

Recombinant BNIP1 Antibody

Sign In for Pricing
View Details
Recombinant BNIP1 Antibody
RC-15592-03 1 mL

Recombinant BNIP1 Antibody

Sign In for Pricing
View Details
Histone H1 (1415-1), CF740 conjugate, 0.1mg/mL
BNC740580-500 1x 500 µL

Histone H1 (1415-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details