Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM15 Rabbit Polyclonal Antibody (Biotin)

PRDM15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PFM15, ZNF298, C21orf83

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PRDM15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SILTVTFDTVSGSAMLHNRQNDVQIHPQPEASNPQSVAHFINLTTLVNSI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_658984

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ppp1r1b shRNA (UAS) - Lentiviral mouse Ppp1r1b shRNA (UAS, GFP) (100)
GTR15265689 1 Vial

Lentiviral mouse Ppp1r1b shRNA (UAS) - Lentiviral mouse Ppp1r1b shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
P53 (Tri Methyl Lys370) rabbit pAb
RA28388-01 50 µL

P53 (Tri Methyl Lys370) rabbit pAb

Sign In for Pricing
View Details
P53 (Tri Methyl Lys370) rabbit pAb
RA28388-02 100 µL

P53 (Tri Methyl Lys370) rabbit pAb

Sign In for Pricing
View Details
LOX antibody
MBS834957-01 0.1 mL

LOX antibody

Sign In for Pricing
View Details
LOX antibody
MBS834957-02 5x 0.1 mL

LOX antibody

Sign In for Pricing
View Details
TRIM37, Recombinant, Human, His-Tag discontinued
591599-01 20 µg

TRIM37, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details