Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM15 Rabbit Polyclonal Antibody (Biotin)

PRDM15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PFM15, ZNF298, C21orf83

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PRDM15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SILTVTFDTVSGSAMLHNRQNDVQIHPQPEASNPQSVAHFINLTTLVNSI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_658984

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(4,6-Diamino-1,3,5-triazin-2-yl)sulfanylethanesulfonic Acid
TRC-D416770-250MG 250 mg

2-(4,6-Diamino-1,3,5-triazin-2-yl)sulfanylethanesulfonic Acid

Sign In for Pricing
View Details
Mouse Ripor3 activation kit by CRISPRa
GA208225 1 Kit

Mouse Ripor3 activation kit by CRISPRa

Sign In for Pricing
View Details
1-(4,5-Dihydro-2-thiazolyl)-3-azetidinethiol Hydrochloride
TRC-D454190-250MG 250 mg

1-(4,5-Dihydro-2-thiazolyl)-3-azetidinethiol Hydrochloride

Sign In for Pricing
View Details
CD45 / LCA (Leucocyte Marker) (PTPRC/1147 + PTPRC/1460), CF740 conjugate, 0.1mg/mL
BNC742027-500 1x 500 µL

CD45 / LCA (Leucocyte Marker) (PTPRC/1147 + PTPRC/1460), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RET Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H3]
TA805744AM 100 µL

RET Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H3]

Sign In for Pricing
View Details
Lipin 1 (LPIN1) Mouse Monoclonal Antibody [Clone ID: OTI7H6]
CF806418 100 µg

Lipin 1 (LPIN1) Mouse Monoclonal Antibody [Clone ID: OTI7H6]

Sign In for Pricing
View Details