VEGF164, Rat (CHO)
VEGF164 Protein, Rat (CHO) is a potent mediator of angiogenesis and binds the semaphorin receptor, neuropilin1.
Product Specifications
Product Name Alternative
VEGF164 Protein, Rat (CHO), Rat, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vegf165-protein-rat-cho.html
Purity
95.0
Smiles
APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular Formula
83785 (Gene_ID) P16612-2 (A27-R190) (Accession)
Molecular Weight
Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Robinson CJ, et al. The splice variants of vascular endothelial growth factor (VEGF) and their receptors. J Cell Sci. 2001 Mar;114 (Pt 5) :853-65.|[2]Byrne AM, et al. Angiogenic and cell survival functions of vascular endothelial growth factor (VEGF) . J Cell Mol Med. 2005 Oct-Dec;9 (4) :777-94.|[3]Qi Pan, et al. Neuropilin-1 Binds to VEGF121 and Regulates Endothelial Cell Migration and Sprouting. The Journal of Biological Chemistry 282, 24049-24056.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402398-100 1x 100 µL
SOX9 / SRY-box 9 (SOX9/2398), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
