Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF285A Rabbit Polyclonal Antibody (Biotin)

ZNF285A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF285A

UniProt

Q96NJ3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF285A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PYEFHEWPMGCKQSSDLPRYQKVSSGDKPYKCKECGKGFRRSSSLHNHHR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_689567

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDB1 (DNA Damage-binding Protein 1, DDB p127 Subunit, DNA Damage-binding Protein a, DDBa, Damage-specific DNA-binding Protein 1, HBV X-associated Protein 1, XAP-1, UV-damaged DNA-binding Factor, UV-damaged DNA-binding Protein 1, UV-DDB 1, XPE-binding Fact
MBS6232450-01 0.1 mL

DDB1 (DNA Damage-binding Protein 1, DDB p127 Subunit, DNA Damage-binding Protein a, DDBa, Damage-specific DNA-binding Protein 1, HBV X-associated Protein 1, XAP-1, UV-damaged DNA-binding Factor, UV-damaged DNA-binding Protein 1, UV-DDB 1, XPE-binding Fact

Sign In for Pricing
View Details
DDB1 (DNA Damage-binding Protein 1, DDB p127 Subunit, DNA Damage-binding Protein a, DDBa, Damage-specific DNA-binding Protein 1, HBV X-associated Protein 1, XAP-1, UV-damaged DNA-binding Factor, UV-damaged DNA-binding Protein 1, UV-DDB 1, XPE-binding Fact
MBS6232450-02 5x 0.1 mL

DDB1 (DNA Damage-binding Protein 1, DDB p127 Subunit, DNA Damage-binding Protein a, DDBa, Damage-specific DNA-binding Protein 1, HBV X-associated Protein 1, XAP-1, UV-damaged DNA-binding Factor, UV-damaged DNA-binding Protein 1, UV-DDB 1, XPE-binding Fact

Sign In for Pricing
View Details
Annexin A13 (ANXA13) Human shRNA Lentiviral Particle (Locus ID 312)
TL314773V 500 µL Each

Annexin A13 (ANXA13) Human shRNA Lentiviral Particle (Locus ID 312)

Sign In for Pricing
View Details
ELISA Kit For Proteolipid protein 2
E1253b 96 Tests

ELISA Kit For Proteolipid protein 2

Sign In for Pricing
View Details
Casp6 3'UTR GFP Stable Cell Line
TU251685 1.0 mL

Casp6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
USP42 Lentiviral Activation Particles (m2)
sc-429424-LAC-2 200 µL

USP42 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details