Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF491 Rabbit Polyclonal Antibody (Biotin)

ZNF491 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ34791, MGC126639, MGC126641

UniProt

Q8N8L2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF491

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SFNRNIRTDTGHQPHKCQKFLEKPYKHKQRRKALSHSHCFRTHERPHTRE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_689569

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIF1-Gamma (TRIM33, Ectodermin Homolog, ECTO, RET-FUSED GENE 7, RFG7, TF1G, TIF1GAMMA, TIFGAMMA, TIF1-gamma, PTC7, RET-fused gene 7 Protein, TIF1G, Tripartite Motif-Containing 33, KIAA1113, Protein Rfg7, Tripartite Motif Containing 33) discontinued
215840 50 µg

TIF1-Gamma (TRIM33, Ectodermin Homolog, ECTO, RET-FUSED GENE 7, RFG7, TF1G, TIF1GAMMA, TIFGAMMA, TIF1-gamma, PTC7, RET-fused gene 7 Protein, TIF1G, Tripartite Motif-Containing 33, KIAA1113, Protein Rfg7, Tripartite Motif Containing 33) discontinued

Sign In for Pricing
View Details
Recombinant Gallid herpesvirus 2 Immediate early ICP22-like protein (MDV088)
MBS1341646-01 0.02 mg (E-Coli)

Recombinant Gallid herpesvirus 2 Immediate early ICP22-like protein (MDV088)

Sign In for Pricing
View Details
Recombinant Gallid herpesvirus 2 Immediate early ICP22-like protein (MDV088)
MBS1341646-02 0.1 mg (E-Coli)

Recombinant Gallid herpesvirus 2 Immediate early ICP22-like protein (MDV088)

Sign In for Pricing
View Details
Recombinant Gallid herpesvirus 2 Immediate early ICP22-like protein (MDV088)
MBS1341646-03 0.02 mg (Yeast)

Recombinant Gallid herpesvirus 2 Immediate early ICP22-like protein (MDV088)

Sign In for Pricing
View Details
Recombinant Gallid herpesvirus 2 Immediate early ICP22-like protein (MDV088)
MBS1341646-04 0.1 mg (Yeast)

Recombinant Gallid herpesvirus 2 Immediate early ICP22-like protein (MDV088)

Sign In for Pricing
View Details
Recombinant Gallid herpesvirus 2 Immediate early ICP22-like protein (MDV088)
MBS1341646-05 0.02 mg (Baculovirus)

Recombinant Gallid herpesvirus 2 Immediate early ICP22-like protein (MDV088)

Sign In for Pricing
View Details