Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF690 Rabbit Polyclonal Antibody (FITC)

ZNF690 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF690, Zfp690

UniProt

Q8IWY8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF690

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: APVLFQSPRGFEAGFENEDNSKRDISEEVQLHRTLLARSERKIPRYLHQG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689668

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Beta Synuclein ELISA Kit
MBS068095 Inquire

Pigeon Beta Synuclein ELISA Kit

Sign In for Pricing
View Details
CCDC13 (NM_144719) Human Recombinant Protein
PH31863E1 50 µg

CCDC13 (NM_144719) Human Recombinant Protein

Sign In for Pricing
View Details
SETD7 (C-term) Rabbit Polyclonal Antibody
AP11178PU-N 400 µL

SETD7 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RBBP8, CT (RBBP8, CTIP, DNA endonuclease RBBP8, CtBP-interacting protein, Retinoblastoma-binding protein 8, Retinoblastoma-interacting protein and myosin-like, Sporulation in the absence of SPO11 protein 2 homolog) (PE) discontinued
040875-PE 200 µL

RBBP8, CT (RBBP8, CTIP, DNA endonuclease RBBP8, CtBP-interacting protein, Retinoblastoma-binding protein 8, Retinoblastoma-interacting protein and myosin-like, Sporulation in the absence of SPO11 protein 2 homolog) (PE) discontinued

Sign In for Pricing
View Details
LIM2 Human Over-expression Lysate
orb1371517 20 µg

LIM2 Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit Monoclonal ST2/IL-33R Antibody (2154B) [mFluor Violet 500 SE]
FAB5232MFV500 0.1 mL

Rabbit Monoclonal ST2/IL-33R Antibody (2154B) [mFluor Violet 500 SE]

Sign In for Pricing
View Details