Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF690 Rabbit Polyclonal Antibody (HRP)

ZNF690 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF690, Zfp690

UniProt

Q8IWY8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF690

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APVLFQSPRGFEAGFENEDNSKRDISEEVQLHRTLLARSERKIPRYLHQG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689668

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPKAPK5 (Mitogen-activated Protein Kinase-activated Protein Kinase 5, MAP Kinase-activated Protein Kinase 5, MAPK-activated Protein Kinase 5, MAPKAP Kinase 5, MAPKAPK-5, p38-regulated/activated Protein Kinase, PRAK) (MaxLight 490)
129419-ML490 100 µL

MAPKAPK5 (Mitogen-activated Protein Kinase-activated Protein Kinase 5, MAP Kinase-activated Protein Kinase 5, MAPK-activated Protein Kinase 5, MAPKAP Kinase 5, MAPKAPK-5, p38-regulated/activated Protein Kinase, PRAK) (MaxLight 490)

Sign In for Pricing
View Details
PPP2R5C (KIAA0044, Serine/Threonine-protein Phosphatase 2A 56kD Regulatory Subunit gamma Isoform, PP2A B Subunit Isoform B'-gamma, PP2A B Subunit Isoform B56-gamma, PP2A B Subunit Isoform PR61-gamma, PP2A B Subunit Isoform R5-gamma, Renal Carcinoma Antigen NY-REN-29, MGC23064) (MaxLight 405) discontinued
131722-ML405 100 µL

PPP2R5C (KIAA0044, Serine/Threonine-protein Phosphatase 2A 56kD Regulatory Subunit gamma Isoform, PP2A B Subunit Isoform B'-gamma, PP2A B Subunit Isoform B56-gamma, PP2A B Subunit Isoform PR61-gamma, PP2A B Subunit Isoform R5-gamma, Renal Carcinoma Antigen NY-REN-29, MGC23064) (MaxLight 405) discontinued

Sign In for Pricing
View Details
MET (NM_000245) Human Recombinant Protein
TP762409 50 µg

MET (NM_000245) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal RPGR Antibody [Alexa Fluor 350]
NBP2-97791AF350 0.1 mL

Rabbit Polyclonal RPGR Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Human BTG3 Protein Lysate
MBS138120-01 0.02 mg

Human BTG3 Protein Lysate

Sign In for Pricing
View Details
Human BTG3 Protein Lysate
MBS138120-02 5x 0.02 mg

Human BTG3 Protein Lysate

Sign In for Pricing
View Details