Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF690 Rabbit Polyclonal Antibody (Biotin)

ZNF690 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF690, Zfp690

UniProt

Q8IWY8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF690

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: APVLFQSPRGFEAGFENEDNSKRDISEEVQLHRTLLARSERKIPRYLHQG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689668

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (MaxLight 490)
251796-ML490 100 µL

SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (MaxLight 490)

Sign In for Pricing
View Details
LRRC10B Double Nickase Plasmid (h)
sc-408429-NIC 20 µg

LRRC10B Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Mouse Monoclonal SP110 Antibody (OTI4C1) [Alexa Fluor 532]
NBP2-74306AF532 0.1 mL

Mouse Monoclonal SP110 Antibody (OTI4C1) [Alexa Fluor 532]

Sign In for Pricing
View Details
CD104 (Integrin beta-4, GP150, ITGB4)
C2446-01Q 100 µg

CD104 (Integrin beta-4, GP150, ITGB4)

Sign In for Pricing
View Details
OPTN (FIP2, GLC1E, HIP7, HYPL, NRP, Optineurin, E3-14.7K-interacting Protein, FIP-2, Huntingtin Yeast Partner L, Huntingtin-interacting Protein 7, Huntingtin-interacting Protein L, NEMO-related Protein, Optic Neuropathy-inducing Protein, Transcription Factor IIIA-interacting Protein) (MaxLight 650)
130731-ML650 100 µL

OPTN (FIP2, GLC1E, HIP7, HYPL, NRP, Optineurin, E3-14.7K-interacting Protein, FIP-2, Huntingtin Yeast Partner L, Huntingtin-interacting Protein 7, Huntingtin-interacting Protein L, NEMO-related Protein, Optic Neuropathy-inducing Protein, Transcription Factor IIIA-interacting Protein) (MaxLight 650)

Sign In for Pricing
View Details
CEMIP Rabbit Polyclonal Antibody
55552-01 50 µL

CEMIP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details