Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF597 Rabbit Polyclonal Antibody (Biotin)

ZNF597 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HIT-4

UniProt

Q96LX8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF597

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GLAQHQKSHSAENTYESTNCDKHFNEKPNLALPEETFVSGPQYQHTKCMK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_689670

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MKRN3 (D15S9, RNF63, ZNF127, Probable E3 Ubiquitin-protein Ligase Makorin-3, RING Finger Protein 63, Zinc Finger Protein 127, MGC88288) (MaxLight 750) discontinued
129712-ML750 100 µL

MKRN3 (D15S9, RNF63, ZNF127, Probable E3 Ubiquitin-protein Ligase Makorin-3, RING Finger Protein 63, Zinc Finger Protein 127, MGC88288) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Recombinant Fasciola hepatica Cathepsin L-like cysteine proteinase
MBS1131432-01 0.02 mg (E-Coli)

Recombinant Fasciola hepatica Cathepsin L-like cysteine proteinase

Sign In for Pricing
View Details
Recombinant Fasciola hepatica Cathepsin L-like cysteine proteinase
MBS1131432-02 0.1 mg (E-Coli)

Recombinant Fasciola hepatica Cathepsin L-like cysteine proteinase

Sign In for Pricing
View Details
Recombinant Fasciola hepatica Cathepsin L-like cysteine proteinase
MBS1131432-03 0.02 mg (Yeast)

Recombinant Fasciola hepatica Cathepsin L-like cysteine proteinase

Sign In for Pricing
View Details
Recombinant Fasciola hepatica Cathepsin L-like cysteine proteinase
MBS1131432-04 0.1 mg (Yeast)

Recombinant Fasciola hepatica Cathepsin L-like cysteine proteinase

Sign In for Pricing
View Details
Recombinant Fasciola hepatica Cathepsin L-like cysteine proteinase
MBS1131432-05 0.02 mg (Baculovirus)

Recombinant Fasciola hepatica Cathepsin L-like cysteine proteinase

Sign In for Pricing
View Details