Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF417 Rabbit Polyclonal Antibody (HRP)

ZNF417 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC34079

UniProt

Q8TAU3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF417

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HQETHHKQKLNRSGACGKNLDDTAYLHQHQKQHIGEKFYRKSVREASFVK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_689688

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Homeo box C10 (HOXC10) Rabbit Polyclonal Antibody
TA345213 100 µL

Homeo box C10 (HOXC10) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Aristolochic acid D
TBZ2849 20mg

Aristolochic acid D

Sign In for Pricing
View Details
USP12 HDR Plasmid (m)
sc-423587-HDR 20 µg

USP12 HDR Plasmid (m)

Sign In for Pricing
View Details
Trpc6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7025508 1.0 µg DNA

Trpc6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
RN112 rabbit pAb
E28PT6529 100 µL

RN112 rabbit pAb

Sign In for Pricing
View Details
GDI1 (Guanosine Diphosphate Dissociation Inhibitor 1, GDP Dissociation Inhibitor 1, GDI-1, FLJ41411, GDIL, MRX41, MRX48, Oligophrenin-2, OPHN2, Protein XAP-4, Rab GDP Dissociation Inhibitor alpha, Rab GDI alpha, RABGDIA, XAP4) (MaxLight 750) discontinued
127258-ML750 100 µL

GDI1 (Guanosine Diphosphate Dissociation Inhibitor 1, GDP Dissociation Inhibitor 1, GDI-1, FLJ41411, GDIL, MRX41, MRX48, Oligophrenin-2, OPHN2, Protein XAP-4, Rab GDP Dissociation Inhibitor alpha, Rab GDI alpha, RABGDIA, XAP4) (MaxLight 750) discontinued

Sign In for Pricing
View Details