Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF433 Rabbit Polyclonal Antibody (HRP)

ZNF433 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ40981

UniProt

Q8N7K0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF433

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VYGEVGSAHSSLNRHIRDDTGHKAYEYQEYGQKPYKCKYCKKPFNCLSSV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001073880

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENPP1 (Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 1, E-NPP 1, Membrane Component Chromosome 6 Surface Marker 1, Phosphodiesterase I/Nucleotide Pyrophosphatase 1, Plasma-cell Membrane Glycoprotein PC-1, M6S1, NPPS, PC1, PDNP1)
126339 50 µg

ENPP1 (Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 1, E-NPP 1, Membrane Component Chromosome 6 Surface Marker 1, Phosphodiesterase I/Nucleotide Pyrophosphatase 1, Plasma-cell Membrane Glycoprotein PC-1, M6S1, NPPS, PC1, PDNP1)

Sign In for Pricing
View Details
ERp44 Rabbit mAb
C05901-100uL 100 µL

ERp44 Rabbit mAb

Sign In for Pricing
View Details
Ras, H (Harvey Murine Sarcoma Virus Oncogene, Ha-Ras)
R1198-34A 100 µL

Ras, H (Harvey Murine Sarcoma Virus Oncogene, Ha-Ras)

Sign In for Pricing
View Details
CXCR4 (CD184, D2S201E, FB22, fusin, HM89, NPYRL, LCR1, HSY3RR, LESTR, NPY3R, NPYR, NPYY3R, SDF-1 receptor, chemokine (C-X-C motif), receptor 4 (fusin), Leukocyte-derived seven transmembrane domain receptor, Stromal cell-derived factor 1 receptor)
144412 100 µg

CXCR4 (CD184, D2S201E, FB22, fusin, HM89, NPYRL, LCR1, HSY3RR, LESTR, NPY3R, NPYR, NPYY3R, SDF-1 receptor, chemokine (C-X-C motif), receptor 4 (fusin), Leukocyte-derived seven transmembrane domain receptor, Stromal cell-derived factor 1 receptor)

Sign In for Pricing
View Details
DMAT
A3368-50 50 mg

DMAT

Sign In for Pricing
View Details
WDR83 ORF Vector (Human) (pORF)
ORF035895 1.0 µg DNA

WDR83 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details