Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF92 Rabbit Polyclonal Antibody (HRP)

ZNF92 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TF12, HPF12, HTF12, HEL-203

UniProt

Q03936

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF92

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPYKYEECDKAFNKFSTLITHQIIYTGEKPCKHECGRAFNKSSNYTKEKL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

NP_009070

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gdap1l1 Rabbit Polyclonal Antibody (Biotin)
orb2112595 100 µL

Gdap1l1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
LIR-6/LILRA1 Rabbit Polyclonal Antibody (Cy7)
orb1049292 100 µL

LIR-6/LILRA1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
DTX2 Antibody
CSB-PA803123ESR2HU-01 50 μL

DTX2 Antibody

Sign In for Pricing
View Details
DTX2 Antibody
CSB-PA803123ESR2HU-02 100 µL

DTX2 Antibody

Sign In for Pricing
View Details
Anti-PD-1H [mam82]
orb758790 0.2 mg

Anti-PD-1H [mam82]

Sign In for Pricing
View Details
LIN7B, NT (LIN7B, MALS2, VELI2, Protein lin-7 homolog B, Mammalian lin-seven protein 2, Vertebrate lin-7 homolog 2) (APC) discontinued
037803-APC 200 µL

LIN7B, NT (LIN7B, MALS2, VELI2, Protein lin-7 homolog B, Mammalian lin-seven protein 2, Vertebrate lin-7 homolog 2) (APC) discontinued

Sign In for Pricing
View Details