Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEIS2 Rabbit Polyclonal Antibody (HRP)

MEIS2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRG1, CPCMR, HsT18361

UniProt

O14770

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MEIS2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFH

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_733775

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1C (NM_001765) Human Over-expression Lysate
LY419762 100 µg

CD1C (NM_001765) Human Over-expression Lysate

Sign In for Pricing
View Details
Caveolin 2 (CAV2) (NM_198212) Human Over-expression Lysate
LY403682 100 µg

Caveolin 2 (CAV2) (NM_198212) Human Over-expression Lysate

Sign In for Pricing
View Details
Ccdc115 (NM_027159) Mouse Tagged ORF Clone
MG201615 10 µg

Ccdc115 (NM_027159) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
LARP4 Human Gene Knockout Kit (CRISPR)
KN415100 1 Kit

LARP4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Electrolyte Analyzer BANA-202
BANA-202 1 Unit

Electrolyte Analyzer BANA-202

Sign In for Pricing
View Details
Histone H1.2 (HIST1H1C) Human Gene Knockout Kit (CRISPR)
KN401249 1 Kit

Histone H1.2 (HIST1H1C) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details