Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSX6P Rabbit Polyclonal Antibody (HRP)

SSX6P Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SSX6, SSXP2, psiSSX2, dJ54B20.1

UniProt

Q7RTT6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SSX6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IPKIMPEKPAEEGSDSKGVPEASGPQNDGKKLCPPGKASSSEKIHERSGP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_775493

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Homer Recombinant Antibody, PerCP Conjugated
bsm-62742R-PerCP 100 µL

Homer Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
ETFA Antibody
GWB-MT307A 50 µg

ETFA Antibody

Sign In for Pricing
View Details
NR4A2 (Nuclear Receptor Subfamily 4 Group A Member 2, Immediate-early Response Protein NOT, Orphan Nuclear Receptor NURR1, Transcriptionally-inducible Nuclear Receptor, NOT, NURR1, TINUR) (MaxLight 490)
130558-ML490 100 µL

NR4A2 (Nuclear Receptor Subfamily 4 Group A Member 2, Immediate-early Response Protein NOT, Orphan Nuclear Receptor NURR1, Transcriptionally-inducible Nuclear Receptor, NOT, NURR1, TINUR) (MaxLight 490)

Sign In for Pricing
View Details
Staphylococcal nuclease domain-containing protein 1 (SND1) Antibody (Biotin)
abx337807-01 20 µg

Staphylococcal nuclease domain-containing protein 1 (SND1) Antibody (Biotin)

Sign In for Pricing
View Details
Staphylococcal nuclease domain-containing protein 1 (SND1) Antibody (Biotin)
abx337807-02 50 µg

Staphylococcal nuclease domain-containing protein 1 (SND1) Antibody (Biotin)

Sign In for Pricing
View Details
Staphylococcal nuclease domain-containing protein 1 (SND1) Antibody (Biotin)
abx337807-03 100 µg

Staphylococcal nuclease domain-containing protein 1 (SND1) Antibody (Biotin)

Sign In for Pricing
View Details