Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF596 Rabbit Polyclonal Antibody (Biotin)

ZNF596 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ36123

UniProt

Q8TC21

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF596

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AFNRSYNFRLHRRVHTGEKPYVCPLCGKAFSKFFNLRQHERTHTKKAMNM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Porcine, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_775810

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal West Nile Virus MP Antibody [Alexa Fluor 350]
NBP2-41053AF350 0.1 mL

Rabbit Polyclonal West Nile Virus MP Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
MED8 Protein Vector (Rat) (pPB-N-His)
PV281767 500 ng

MED8 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
GPSM1, ID (GPSM1, AGS3, G-protein-signaling modulator 1, Activator of G-protein signaling 3) (MaxLight 750)
MBS6304160-01 0.1 mL

GPSM1, ID (GPSM1, AGS3, G-protein-signaling modulator 1, Activator of G-protein signaling 3) (MaxLight 750)

Sign In for Pricing
View Details
GPSM1, ID (GPSM1, AGS3, G-protein-signaling modulator 1, Activator of G-protein signaling 3) (MaxLight 750)
MBS6304160-02 5x 0.1 mL

GPSM1, ID (GPSM1, AGS3, G-protein-signaling modulator 1, Activator of G-protein signaling 3) (MaxLight 750)

Sign In for Pricing
View Details
Rabbit anti-Homo sapiens (Human) PHF1 Polyclonal Antibody
MBS7141149 Inquire

Rabbit anti-Homo sapiens (Human) PHF1 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ptpn9 shRNA (UAS) - Lentiviral mouse Ptpn9 shRNA (UAS, GFP) (100)
GTR15227709 1 Vial

Lentiviral mouse Ptpn9 shRNA (UAS) - Lentiviral mouse Ptpn9 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details