Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF660 Rabbit Polyclonal Antibody (HRP)

ZNF660 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ36870

UniProt

Q6AZW8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF660

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRKTRNFKHKTVKDNKVLTEGSDQESEKDNSQCCDPATNERVQAEKRQYV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_775929

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL32 (Interleukin-32, Natural Killer Cells Protein 4, Tumor Necrosis Factor alpha-inducing Factor, IL-32, NK4, TAIF) (FITC)
MBS6261894-01 0.1 mL

IL32 (Interleukin-32, Natural Killer Cells Protein 4, Tumor Necrosis Factor alpha-inducing Factor, IL-32, NK4, TAIF) (FITC)

Sign In for Pricing
View Details
IL32 (Interleukin-32, Natural Killer Cells Protein 4, Tumor Necrosis Factor alpha-inducing Factor, IL-32, NK4, TAIF) (FITC)
MBS6261894-02 5x 0.1 mL

IL32 (Interleukin-32, Natural Killer Cells Protein 4, Tumor Necrosis Factor alpha-inducing Factor, IL-32, NK4, TAIF) (FITC)

Sign In for Pricing
View Details
GCN5, Recombinant, Human, aa727-837, His-Tag (Histone Acetyltransferase KAT2A)
298410 100 µg

GCN5, Recombinant, Human, aa727-837, His-Tag (Histone Acetyltransferase KAT2A)

Sign In for Pricing
View Details
Guinea pig Cylicin-1 (CYLC1) ELISA Kit
MBS7224276-01 48 Well

Guinea pig Cylicin-1 (CYLC1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cylicin-1 (CYLC1) ELISA Kit
MBS7224276-02 96 Well

Guinea pig Cylicin-1 (CYLC1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cylicin-1 (CYLC1) ELISA Kit
MBS7224276-03 5x 96 Well

Guinea pig Cylicin-1 (CYLC1) ELISA Kit

Sign In for Pricing
View Details