Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAZF1 Rabbit Polyclonal Antibody (HRP)

JAZF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TIP27, ZNF802

UniProt

Q86VZ6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human JAZF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_778231

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

liver FABP (FABP1) (NM_001443) Human Over-expression Lysate
LC400559 20 µg

liver FABP (FABP1) (NM_001443) Human Over-expression Lysate

Sign In for Pricing
View Details
SP3/4 Antibody
E51A02492 100 µL

SP3/4 Antibody

Sign In for Pricing
View Details
Anti-human DC-SIGN / CD209 (INSERM patent Anti-DC-SIGN Biosimilar)
BIO0147SM-20mg 20 mg

Anti-human DC-SIGN / CD209 (INSERM patent Anti-DC-SIGN Biosimilar)

Sign In for Pricing
View Details
Ca2+-ATPase Assay Kit
SH0232-3 50 Tests - 25 Samples

Ca2+-ATPase Assay Kit

Sign In for Pricing
View Details
SNAP29 polyclonal rabbit affinity purified
111 303 50 µg

SNAP29 polyclonal rabbit affinity purified

Sign In for Pricing
View Details
Lentiviral human ZFHX2 shRNA (UAS) - Lentiviral human ZFHX2 shRNA (UAS, RFP) plasmid
GTR15325516 1 Vial

Lentiviral human ZFHX2 shRNA (UAS) - Lentiviral human ZFHX2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details