Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAZF1 Rabbit Polyclonal Antibody (HRP)

JAZF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TIP27, ZNF802

UniProt

Q86VZ6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human JAZF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_778231

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1331 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
33847116 3x 1.0 µg

Olr1331 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Hsa-miR-449b-5p mimic
HY-R01111-01 5 nmol

Hsa-miR-449b-5p mimic

Sign In for Pricing
View Details
Hsa-miR-449b-5p mimic
HY-R01111-02 20 nmol

Hsa-miR-449b-5p mimic

Sign In for Pricing
View Details
UNC5D (Protein Unc-5 Homolog D, Netrin Receptor UNC5D, Protein Unc-5 Homolog 4, UNC5H4, KIAA1777, UNQ6012/PRO34692) (HRP)
135109-HRP 100 µL

UNC5D (Protein Unc-5 Homolog D, Netrin Receptor UNC5D, Protein Unc-5 Homolog 4, UNC5H4, KIAA1777, UNQ6012/PRO34692) (HRP)

Sign In for Pricing
View Details
Cat Kit ligand, KITLG ELISA Kit
MBS9323528 Inquire

Cat Kit ligand, KITLG ELISA Kit

Sign In for Pricing
View Details
RAD18 Protein Vector (Rat) (pPB-N-His)
PV297951 500 ng

RAD18 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details