Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF227 Rabbit Polyclonal Antibody (HRP)

ZNF227 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q86WZ6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF227

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QIWKQVASELTRCLQGKSSQLLQGDSIQVSENENNIMNPKGDSSIYIENQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_872296

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Brain
CS642694 5x 5 µm

Frozen Tissue Sections, Brain

Sign In for Pricing
View Details
Cycloxygenase-2 (COX-2) (COX2/1941), CF647 conjugate, 0.1mg/mL
BNC472377-100 1x 100 µL

Cycloxygenase-2 (COX-2) (COX2/1941), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tigd4 Mouse Gene Knockout Kit (CRISPR)
KN517565 1 Kit

Tigd4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD8 (C8/144B), Biotin conjugate, 0.1mg/mL
BNCB0749-100 1x 100 µL

CD8 (C8/144B), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Syntrophin alpha 1 (SNTA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E10]
TA502038AM 100 µL

Syntrophin alpha 1 (SNTA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E10]

Sign In for Pricing
View Details
N-Ethyl Maleimide (1M Solution in Acetonitrile)
TRC-KIT4159-1X5ML 5 mL

N-Ethyl Maleimide (1M Solution in Acetonitrile)

Sign In for Pricing
View Details