Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF534 Rabbit Polyclonal Antibody (HRP)

ZNF534 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KRBO3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF534

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VFRVEAWRASGGAEEPTGPNFVGNDSPLPSPLALLPFPSVSASLGDAKRA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_872318

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine TIMP2 / Metalloproteinase inhibitor 2 Recombinant Protein
R0128b 1 Each

Bovine TIMP2 / Metalloproteinase inhibitor 2 Recombinant Protein

Sign In for Pricing
View Details
Isocitrate Dehydrogenase, CT (Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial [Precursor], Isocitric dehydrogenase, NAD (+) -specific ICDH, IDH3A, IDH3) (Biotin) discontinued
I8850-01E-Biotin 200 µL

Isocitrate Dehydrogenase, CT (Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial [Precursor], Isocitric dehydrogenase, NAD (+) -specific ICDH, IDH3A, IDH3) (Biotin) discontinued

Sign In for Pricing
View Details
2-Z-6-Chloro-3,4-dihydro-1H-isoquinoline-1-carboxylic acid
sc-471080 250 mg

2-Z-6-Chloro-3,4-dihydro-1H-isoquinoline-1-carboxylic acid

Sign In for Pricing
View Details
SLC25A18 Antibody, FITC conjugated
A69415-100UG 100 µg

SLC25A18 Antibody, FITC conjugated

Sign In for Pricing
View Details
Human PRSS2 (NM_002770) AAV Particle
RC214231A1V 250 µL

Human PRSS2 (NM_002770) AAV Particle

Sign In for Pricing
View Details
Component of Oligomeric Golgi Complex 3 (COG3) Antibody
abx026276-01 80 µL

Component of Oligomeric Golgi Complex 3 (COG3) Antibody

Sign In for Pricing
View Details