Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF778 Rabbit Polyclonal Antibody (FITC)

ZNF778 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ31875, MGC150573

UniProt

Q96MU6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF778

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ARSHNGGQLCDRTQCGEAFSEHSGLSTHVRTQNTGDSCVSNHYERDFFIP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_872337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PLCG1 (Tyr775) Rabbit Polyclonal Antibody (AP)
orb1595459 100 µL

Phospho-PLCG1 (Tyr775) Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Recombinant Human Activator of HSP90 ATPase-1
7-06909 1 mg

Recombinant Human Activator of HSP90 ATPase-1

Sign In for Pricing
View Details
Phospho-BLNK (Tyr189) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-9688R-BF350 100 µL

Phospho-BLNK (Tyr189) Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Nutrient Mixture F-12 Ham w/ 2mM L-Glutamine and 1.5gms per litre Sodium bicarbonate
AL1025S-01 500 mL

Nutrient Mixture F-12 Ham w/ 2mM L-Glutamine and 1.5gms per litre Sodium bicarbonate

Sign In for Pricing
View Details
Nutrient Mixture F-12 Ham w/ 2mM L-Glutamine and 1.5gms per litre Sodium bicarbonate
AL1025S-02 2x 500 mL

Nutrient Mixture F-12 Ham w/ 2mM L-Glutamine and 1.5gms per litre Sodium bicarbonate

Sign In for Pricing
View Details
Nutrient Mixture F-12 Ham w/ 2mM L-Glutamine and 1.5gms per litre Sodium bicarbonate
AL1025S-03 6x 500 mL

Nutrient Mixture F-12 Ham w/ 2mM L-Glutamine and 1.5gms per litre Sodium bicarbonate

Sign In for Pricing
View Details