Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF778 Rabbit Polyclonal Antibody (FITC)

ZNF778 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ31875, MGC150573

UniProt

Q96MU6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF778

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ARSHNGGQLCDRTQCGEAFSEHSGLSTHVRTQNTGDSCVSNHYERDFFIP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_872337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sorbic Acid-13C2
TRC-S676891-1MG 1 mg

Sorbic Acid-13C2

Sign In for Pricing
View Details
sdeA Antibody, HRP Conjugated
MBS7134040-01 0.05 mL

sdeA Antibody, HRP Conjugated

Sign In for Pricing
View Details
sdeA Antibody, HRP Conjugated
MBS7134040-02 0.1 mL

sdeA Antibody, HRP Conjugated

Sign In for Pricing
View Details
sdeA Antibody, HRP Conjugated
MBS7134040-03 5x 0.1 mL

sdeA Antibody, HRP Conjugated

Sign In for Pricing
View Details
TSG101, CT (Tumor Susceptibility Gene 101 Protein, ESCRT-I Complex Subunit TSG101) (MaxLight 405)
MBS6504011-01 0.1 mL

TSG101, CT (Tumor Susceptibility Gene 101 Protein, ESCRT-I Complex Subunit TSG101) (MaxLight 405)

Sign In for Pricing
View Details
TSG101, CT (Tumor Susceptibility Gene 101 Protein, ESCRT-I Complex Subunit TSG101) (MaxLight 405)
MBS6504011-02 5x 0.1 mL

TSG101, CT (Tumor Susceptibility Gene 101 Protein, ESCRT-I Complex Subunit TSG101) (MaxLight 405)

Sign In for Pricing
View Details