Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ33706 Rabbit Polyclonal Antibody (HRP)

FLJ33706 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8NBC4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ33706

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RMGTVGDFGQALSSLAWTSTCFQDFCLPSLPGKLPAPLISKQQFLSNSSR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

221kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_872390

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken adiponectin, ADP ELISA KIT
EA0016Ch-01 96 Well

Chicken adiponectin, ADP ELISA KIT

Sign In for Pricing
View Details
Chicken adiponectin, ADP ELISA KIT
EA0016Ch-02 5x 96 Tests

Chicken adiponectin, ADP ELISA KIT

Sign In for Pricing
View Details
Chicken adiponectin, ADP ELISA KIT
EA0016Ch-03 10x 96 Tests

Chicken adiponectin, ADP ELISA KIT

Sign In for Pricing
View Details
Sheep Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2) ELISA Kit
MBS7208757-01 48 Well

Sheep Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2) ELISA Kit

Sign In for Pricing
View Details
Sheep Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2) ELISA Kit
MBS7208757-02 96 Well

Sheep Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2) ELISA Kit

Sign In for Pricing
View Details
Sheep Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2) ELISA Kit
MBS7208757-03 5x 96 Well

Sheep Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2) ELISA Kit

Sign In for Pricing
View Details