Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF713 Rabbit Polyclonal Antibody (HRP)

ZNF713 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8N859

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF713

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ERLAGDSFWYSILGGLWDFDYHPEFNQENHKRYLGQVTLTHKKITQERSL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Porcine, Yeast

Tested Applications

WB

NCBI Accession Number

NP_872439

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIKE1 Protein Vector (Rat) (pPB-N-His)
PV304987 500 ng

SIKE1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Hnrnpl (NM_032619) Rat Untagged Clone
RN200290 10 µg

Hnrnpl (NM_032619) Rat Untagged Clone

Sign In for Pricing
View Details
Recombinant Oceanobacillus iheyensis Foldase protein prsA (prsA)
MBS1409809-01 0.02 mg (E-Coli)

Recombinant Oceanobacillus iheyensis Foldase protein prsA (prsA)

Sign In for Pricing
View Details
Recombinant Oceanobacillus iheyensis Foldase protein prsA (prsA)
MBS1409809-02 0.02 mg (Yeast)

Recombinant Oceanobacillus iheyensis Foldase protein prsA (prsA)

Sign In for Pricing
View Details
Recombinant Oceanobacillus iheyensis Foldase protein prsA (prsA)
MBS1409809-03 0.1 mg (E-Coli)

Recombinant Oceanobacillus iheyensis Foldase protein prsA (prsA)

Sign In for Pricing
View Details
Recombinant Oceanobacillus iheyensis Foldase protein prsA (prsA)
MBS1409809-04 0.1 mg (Yeast)

Recombinant Oceanobacillus iheyensis Foldase protein prsA (prsA)

Sign In for Pricing
View Details