Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF835 Rabbit Polyclonal Antibody (FITC)

ZNF835 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BC37295_3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF835

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YTCQDCGALFSQSASLAEHRRIHTGEKPYACGQCAKAFTQVSHLTQHQRT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_032059

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), 0.2mg/mL
BNUB2571-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), 0.2mg/mL

Sign In for Pricing
View Details
(5Z)-5-Dodecenoic Acid
TRC-D535350-50MG 50 mg

(5Z)-5-Dodecenoic Acid

Sign In for Pricing
View Details
MAPK14 (CPTC-MAPK14-1), CF568 conjugate, 0.1mg/mL
BNC682228-500 1x 500 µL

MAPK14 (CPTC-MAPK14-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Iminothiolane Hydrochloride
TRC-I450000-1G 1 g

2-Iminothiolane Hydrochloride

Sign In for Pricing
View Details
Elab Fluor® 647 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802M-01 20 Tests

Elab Fluor® 647 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® 647 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802M-02 100 Tests

Elab Fluor® 647 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details