Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF799 Rabbit Polyclonal Antibody (FITC)

ZNF799 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HIT-40, ZNF842

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of human ZNF799

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VIMGHSSLNCYIRVGAGHKPYEYHECGEKPDTHKQRGKAFSYHNSLQTHE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_032678

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GJA5 (N-term) Rabbit Polyclonal Antibody
AP11576PU-N 200 µL

GJA5 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Troponin C1 (TNNC1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H5]
TA804824BM 100 µL

Troponin C1 (TNNC1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H5]

Sign In for Pricing
View Details
RBMY1D Human Gene Knockout Kit (CRISPR)
KN418382 1 Kit

RBMY1D Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Caveolin 3 (CAV3) (NM_001234) Human Over-expression Lysate
LC420058 20 µg

Caveolin 3 (CAV3) (NM_001234) Human Over-expression Lysate

Sign In for Pricing
View Details
Rhox2c Mouse Gene Knockout Kit (CRISPR)
KN514786 1 Kit

Rhox2c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NRF1 Recombinant Rabbit monoclonal Antibody [JM89-63]
ET1705-86-50UL 50 µL

NRF1 Recombinant Rabbit monoclonal Antibody [JM89-63]

Sign In for Pricing
View Details