Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF799 Rabbit Polyclonal Antibody (FITC)

ZNF799 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HIT-40, ZNF842

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF799

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AFPDYSSCLRHERTHTGKKPYTCKQCGKAFSASTSLRRHETTHTDEKPYA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

XP_032678

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABAA Rα1 CRISPR Activation Plasmid (h)
sc-401038-ACT 20 µg

GABAA Rα1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
SLAMF8 siRNA (Human)
MBS8203750-01 15 nmol

SLAMF8 siRNA (Human)

Sign In for Pricing
View Details
SLAMF8 siRNA (Human)
MBS8203750-02 30 nmol

SLAMF8 siRNA (Human)

Sign In for Pricing
View Details
SLAMF8 siRNA (Human)
MBS8203750-03 5x 30 nmol

SLAMF8 siRNA (Human)

Sign In for Pricing
View Details
LOC100361053 3'UTR Luciferase Stable Cell Line
TU207812 1.0 mL

LOC100361053 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human Osteocalcin/BGLAP/OC Protein, N-His
AP90508 50 µg

Recombinant Human Osteocalcin/BGLAP/OC Protein, N-His

Sign In for Pricing
View Details