Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF799 Rabbit Polyclonal Antibody (HRP)

ZNF799 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HIT-40, ZNF842

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF799

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AFPDYSSCLRHERTHTGKKPYTCKQCGKAFSASTSLRRHETTHTDEKPYA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

XP_032678

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mup19 Protein Vector (Mouse) (pPB-N-His)
PV203103 500 ng

Mup19 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human ZNF441 knockout cell line
ABC-KH17548 1 Vial

Human ZNF441 knockout cell line

Sign In for Pricing
View Details
Anti-B. Anthracis Anthrax protective antigen 83 (PA83) (C-terminal peptide) IgG
PA17-A 100 µg

Anti-B. Anthracis Anthrax protective antigen 83 (PA83) (C-terminal peptide) IgG

Sign In for Pricing
View Details
RASAL2 Antibody
orb1269248 400 μl

RASAL2 Antibody

Sign In for Pricing
View Details
Plakophilin 2 antibody (2a + 2b)
10R-P130B 5 mL

Plakophilin 2 antibody (2a + 2b)

Sign In for Pricing
View Details
Caprin1 (F-3) FITC
sc-518251 FITC 200 µg/mL

Caprin1 (F-3) FITC

Sign In for Pricing
View Details