Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF799 Rabbit Polyclonal Antibody (HRP)

ZNF799 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HIT-40, ZNF842

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF799

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AFPDYSSCLRHERTHTGKKPYTCKQCGKAFSASTSLRRHETTHTDEKPYA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

XP_032678

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyrazine-2,3-dicarboxylic acid
HY-W017105-01 50 g

Pyrazine-2,3-dicarboxylic acid

Sign In for Pricing
View Details
Pyrazine-2,3-dicarboxylic acid
HY-W017105-02 100 g

Pyrazine-2,3-dicarboxylic acid

Sign In for Pricing
View Details
Pyrazine-2,3-dicarboxylic acid
HY-W017105-03 250 g

Pyrazine-2,3-dicarboxylic acid

Sign In for Pricing
View Details
Pyrazine-2,3-dicarboxylic acid
HY-W017105-04 500 g

Pyrazine-2,3-dicarboxylic acid

Sign In for Pricing
View Details
P2RX5 (P2X5, P2X Purinoceptor 5, ATP Receptor, Purinergic Receptor, MGC47755) (APC)
130791-APC 100 µL

P2RX5 (P2X5, P2X Purinoceptor 5, ATP Receptor, Purinergic Receptor, MGC47755) (APC)

Sign In for Pricing
View Details
Clathrin Light Chain A (CLTA) Protein
abx260911-01 5 µg

Clathrin Light Chain A (CLTA) Protein

Sign In for Pricing
View Details