Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF843 Rabbit Polyclonal Antibody (Biotin)

ZNF843 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8N446

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF843

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WRETLSLSPVRQDLLWPLQPHQAPASPLGRSHSSAGVRQGFSGQLCCWLT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001129981

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DOB (HLA Class II Histocompatibility Antigen, DO beta Chain, MHC Class II Antigen DOB) (MaxLight 405)
MBS6381259-01 0.1 mL

HLA-DOB (HLA Class II Histocompatibility Antigen, DO beta Chain, MHC Class II Antigen DOB) (MaxLight 405)

Sign In for Pricing
View Details
HLA-DOB (HLA Class II Histocompatibility Antigen, DO beta Chain, MHC Class II Antigen DOB) (MaxLight 405)
MBS6381259-02 5x 0.1 mL

HLA-DOB (HLA Class II Histocompatibility Antigen, DO beta Chain, MHC Class II Antigen DOB) (MaxLight 405)

Sign In for Pricing
View Details
Rat Myosin-binding protein C, cardiac-type, Cardiac MyBP-C ELISA Kit
orb1658349 96 Tests

Rat Myosin-binding protein C, cardiac-type, Cardiac MyBP-C ELISA Kit

Sign In for Pricing
View Details
Rat Cystatin C ELISA Kit
MBS731876-01 48 Well

Rat Cystatin C ELISA Kit

Sign In for Pricing
View Details
Rat Cystatin C ELISA Kit
MBS731876-02 96 Well

Rat Cystatin C ELISA Kit

Sign In for Pricing
View Details
Rat Cystatin C ELISA Kit
MBS731876-03 5x 96 Well

Rat Cystatin C ELISA Kit

Sign In for Pricing
View Details