Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF251 Rabbit Polyclonal Antibody (HRP)

ZNF251 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ34319

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF251

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLDQNVVRLQRNKTGERVFKCDICSKTFKYNSDLSRHQRSHTGEKPYECG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_291262

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau (Acetyl Lys174) Polyclonal Antibody
orb399603-01 50 μL

Tau (Acetyl Lys174) Polyclonal Antibody

Sign In for Pricing
View Details
Tau (Acetyl Lys174) Polyclonal Antibody
orb399603-02 100 µL

Tau (Acetyl Lys174) Polyclonal Antibody

Sign In for Pricing
View Details
FGFR4 (Fibroblast Growth Factor Receptor 4, FGFR-4, CD334 Antigen, FGFR4, JTK2, TKF)
126793 100 µg

FGFR4 (Fibroblast Growth Factor Receptor 4, FGFR-4, CD334 Antigen, FGFR4, JTK2, TKF)

Sign In for Pricing
View Details
Anti-E. coli [HEC10-144.2] - 500 μg
15401-500μg 500 µg

Anti-E. coli [HEC10-144.2] - 500 μg

Sign In for Pricing
View Details
SNF8 (EAP30, Vacuolar-sorting Protein SNF8, ELL-associated Protein of 30kD, ESCRT-II Complex Subunit VPS22) (FITC)
MBS6149803-01 0.1 mL

SNF8 (EAP30, Vacuolar-sorting Protein SNF8, ELL-associated Protein of 30kD, ESCRT-II Complex Subunit VPS22) (FITC)

Sign In for Pricing
View Details
SNF8 (EAP30, Vacuolar-sorting Protein SNF8, ELL-associated Protein of 30kD, ESCRT-II Complex Subunit VPS22) (FITC)
MBS6149803-02 5x 0.1 mL

SNF8 (EAP30, Vacuolar-sorting Protein SNF8, ELL-associated Protein of 30kD, ESCRT-II Complex Subunit VPS22) (FITC)

Sign In for Pricing
View Details