Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKAP5 Rabbit Polyclonal Antibody (Biotin)

AKAP5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

H21, AKAP75, AKAP79

UniProt

P24588

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AKAP5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_004848

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100359680 3'UTR Luciferase Stable Cell Line
TU207278 1.0 mL

LOC100359680 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)
MBS7006938-01 0.02 mg

Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Sign In for Pricing
View Details
Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)
MBS7006938-02 0.1 mg

Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Sign In for Pricing
View Details
Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)
MBS7006938-03 5x 0.1 mg

Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Sign In for Pricing
View Details
Nrbp2 Mouse siRNA Oligo Duplex (Locus ID 223649)
SR407303 1 Kit

Nrbp2 Mouse siRNA Oligo Duplex (Locus ID 223649)

Sign In for Pricing
View Details
DGCR2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV709263 1.0 µg DNA

DGCR2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details