Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKAP7 Rabbit Polyclonal Antibody (FITC)

AKAP7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AKAP15, AKAP18

UniProt

Q9P0M2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AKAP7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSN

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057461

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP-A (35kD pulmonary surfactant-associated protein, Alveolar proteinosis protein, Collectin-4)
145210 100 µg

SP-A (35kD pulmonary surfactant-associated protein, Alveolar proteinosis protein, Collectin-4)

Sign In for Pricing
View Details
Lentiviral human CACNA1B shRNA (UAS) - Lentiviral human CACNA1B shRNA (UAS, GFP) (25)
GTR15296543 1 Vial

Lentiviral human CACNA1B shRNA (UAS) - Lentiviral human CACNA1B shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rat Homer Protein Homolog 1 (HOMER1) ELISA Kit
MBS9365597-01 48 Well

Rat Homer Protein Homolog 1 (HOMER1) ELISA Kit

Sign In for Pricing
View Details
Rat Homer Protein Homolog 1 (HOMER1) ELISA Kit
MBS9365597-02 96 Well

Rat Homer Protein Homolog 1 (HOMER1) ELISA Kit

Sign In for Pricing
View Details
Rat Homer Protein Homolog 1 (HOMER1) ELISA Kit
MBS9365597-03 5x 96 Well

Rat Homer Protein Homolog 1 (HOMER1) ELISA Kit

Sign In for Pricing
View Details
Rat Homer Protein Homolog 1 (HOMER1) ELISA Kit
MBS9365597-04 10x 96 Well

Rat Homer Protein Homolog 1 (HOMER1) ELISA Kit

Sign In for Pricing
View Details