Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKAP7 Rabbit Polyclonal Antibody (HRP)

AKAP7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AKAP15, AKAP18

UniProt

Q9P0M2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AKAP7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKLSKSPWLRKNGVKKIDPDLYEKFISHRFGEEILYRIDLCSMLKKKQSN

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057461

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (M3A7), CF640R conjugate, 0.1mg/mL
BNC401827-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (M3A7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HPV-16 (Human Papilloma Virus 16) (rHPV16L1/1058), CF488A conjugate, 0.1mg/mL
BNC882057-100 1x 100 µL

HPV-16 (Human Papilloma Virus 16) (rHPV16L1/1058), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (rKRT10/1275), 0.2mg/mL
BNUB1947-100 1x 100 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (rKRT10/1275), 0.2mg/mL

Sign In for Pricing
View Details
Cytokeratin 5/8 (C-50), CF640R conjugate, 0.1mg/mL
BNC400948-500 1x 500 µL

Cytokeratin 5/8 (C-50), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (A103), CF640R conjugate, 0.1mg/mL
BNC400668-100 1x 100 µL

MART-1 / Melan-A (A103), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/777), CF740 conjugate, 0.1mg/mL
BNC741863-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/777), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details