Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX15 Rabbit Polyclonal Antibody (HRP)

DHX15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DBP1, DDX15, PRP43, PRPF43, PrPp43p

UniProt

O43143

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DHX15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSF

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001349

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Despiperazine Ribociclib Ethylenediamin Hydrochloride
TRC-D215530-50MG 50 mg

Despiperazine Ribociclib Ethylenediamin Hydrochloride

Sign In for Pricing
View Details
Mouse Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) ELISA Kit
RDR-GP1Bb-Mu-01 96 Tests

Mouse Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) ELISA Kit

Sign In for Pricing
View Details
Mouse Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) ELISA Kit
RDR-GP1Bb-Mu-02 48 Tests

Mouse Glycoprotein Ib Beta Polypeptide, Platelet (GP1Bb) ELISA Kit

Sign In for Pricing
View Details
PSMD5 Mouse Monoclonal Antibody [Clone ID: OTI8B1]
CF811921 100 µg

PSMD5 Mouse Monoclonal Antibody [Clone ID: OTI8B1]

Sign In for Pricing
View Details
Trip11 Mouse Gene Knockout Kit (CRISPR)
KN518249 1 Kit

Trip11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SPIN4 activation kit by CRISPRa
GA115356 1 Kit

Human SPIN4 activation kit by CRISPRa

Sign In for Pricing
View Details