Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX16 Rabbit Polyclonal Antibody (HRP)

DHX16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DBP2, PRP8, Prp2, DDX16, NMOAS, PRPF2, PRO2014

UniProt

B4DZ28

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLA

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

107kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001157711

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEX101 (NM_031451) Human Tagged ORF Clone Lentiviral Particle
RC201444L3V 200 µL

TEX101 (NM_031451) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SMG1 Recombinant Antibody, Cy3 Conjugated
bsm-62379R-Cy3 100 µL

SMG1 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
OAEC00311-50UG - ABL1/2 Antibody (Phospho-Tyr393/429)
OAEC00311-50UG 50 µg

OAEC00311-50UG - ABL1/2 Antibody (Phospho-Tyr393/429)

Sign In for Pricing
View Details
Influenza A virus (A/Massachusetts/18/2022) NA (H3N2) Protein, His Tag (SPR verified)
orb2281246-01 100 µg

Influenza A virus (A/Massachusetts/18/2022) NA (H3N2) Protein, His Tag (SPR verified)

Sign In for Pricing
View Details
Influenza A virus (A/Massachusetts/18/2022) NA (H3N2) Protein, His Tag (SPR verified)
orb2281246-02 1 mg

Influenza A virus (A/Massachusetts/18/2022) NA (H3N2) Protein, His Tag (SPR verified)

Sign In for Pricing
View Details
Ncapd3 3'UTR GFP Stable Cell Line
TU263774 1.0 mL

Ncapd3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details