Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RECQL5 Rabbit Polyclonal Antibody (Biotin)

RECQL5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RECQ5

UniProt

Q8WYH5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PP1045

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LTPFYKEGKFASKELFKGFARHLSHLLTQKTSPGRSVKEEAQNLIRHFFH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLRP7 (NM_001127255) Human Tagged Lenti ORF Clone
RC226306L4 10 µg

NLRP7 (NM_001127255) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-DUX4 Antibody
57100-1 100 µg

Anti-DUX4 Antibody

Sign In for Pricing
View Details
Estrogen Receptor beta Antibody
E51A08351 100 µL

Estrogen Receptor beta Antibody

Sign In for Pricing
View Details
MPPED1, ID (MPPED1, C22orf1, FAM1A, Metallophosphoesterase domain-containing protein 1, Adult brain protein 239) (MaxLight 405)
MBS6321971-01 0.1 mL

MPPED1, ID (MPPED1, C22orf1, FAM1A, Metallophosphoesterase domain-containing protein 1, Adult brain protein 239) (MaxLight 405)

Sign In for Pricing
View Details
MPPED1, ID (MPPED1, C22orf1, FAM1A, Metallophosphoesterase domain-containing protein 1, Adult brain protein 239) (MaxLight 405)
MBS6321971-02 5x 0.1 mL

MPPED1, ID (MPPED1, C22orf1, FAM1A, Metallophosphoesterase domain-containing protein 1, Adult brain protein 239) (MaxLight 405)

Sign In for Pricing
View Details
ADRA2A Protein Lysate (Mouse) with C-HA Tag
11446034 100 µg

ADRA2A Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details