Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHD1L Rabbit Polyclonal Antibody (HRP)

CHD1L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ALC1, CHDL

UniProt

Q9H678

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CHD1L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

BAB15386

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Killer Cell Lectin Like Receptor Subfamily D, Member 1 (CD94, KLRD1) (MaxLight 550)
MBS6423885-01 0.1 mL

Killer Cell Lectin Like Receptor Subfamily D, Member 1 (CD94, KLRD1) (MaxLight 550)

Sign In for Pricing
View Details
Killer Cell Lectin Like Receptor Subfamily D, Member 1 (CD94, KLRD1) (MaxLight 550)
MBS6423885-02 5x 0.1 mL

Killer Cell Lectin Like Receptor Subfamily D, Member 1 (CD94, KLRD1) (MaxLight 550)

Sign In for Pricing
View Details
MFluor™ Violet 500 Anti-human CD8 Antibody *OKT-8*
10082101-AAT 500 Tests

MFluor™ Violet 500 Anti-human CD8 Antibody *OKT-8*

Sign In for Pricing
View Details
OKRC01465-96W - Prolactin ELISA Kit (Rat)
OKRC01465-96W 96 Well

OKRC01465-96W - Prolactin ELISA Kit (Rat)

Sign In for Pricing
View Details
Olr801 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7369604 1.0 µg DNA

Olr801 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant Human Cystatin F/CST7 Protein (C-6His)
MBS2552565-01 0.01 mg

Recombinant Human Cystatin F/CST7 Protein (C-6His)

Sign In for Pricing
View Details