Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX5 Rabbit Polyclonal Antibody (FITC)

DDX5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P68, HLR1, G17P1, HUMP68

UniProt

P17844

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DDX5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFY

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004387

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish PFN2a/b Rabbit Polyclonal Antibody (Biotin)
orb2804679 100 µg

Zebrafish PFN2a/b Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Semaphorin 6A (Semaphorin-6A, SEMA6A, HT018, KIAA1368, Semaphorin VIA, Sema VIA, Semaphorin-6A-1, SEMA6A1, SEMA6A-1, SEMAQ, VIA) (AP) discontinued
133108-AP 100 µL

Semaphorin 6A (Semaphorin-6A, SEMA6A, HT018, KIAA1368, Semaphorin VIA, Sema VIA, Semaphorin-6A-1, SEMA6A1, SEMA6A-1, SEMAQ, VIA) (AP) discontinued

Sign In for Pricing
View Details
SOD1 (UbetaB) Antibody: APC
SPC-205D-APC 100 µg

SOD1 (UbetaB) Antibody: APC

Sign In for Pricing
View Details
IMP4 (NM_033416) Human Recombinant Protein
E45H40031M5 20 µg

IMP4 (NM_033416) Human Recombinant Protein

Sign In for Pricing
View Details
MSH5 rabbit pAb Antibody
orb2304589-01 50 µL

MSH5 rabbit pAb Antibody

Sign In for Pricing
View Details
MSH5 rabbit pAb Antibody
orb2304589-02 100 µL

MSH5 rabbit pAb Antibody

Sign In for Pricing
View Details