Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX5 Rabbit Polyclonal Antibody (FITC)

DDX5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P68, HLR1, G17P1, HUMP68

UniProt

P17844

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DDX5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFY

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004387

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Mis12 ELISA Kit
ELI-43727r 96 Tests

Rat Mis12 ELISA Kit

Sign In for Pricing
View Details
M5-117-492 Pre-sized Label Cartridges for Printers
170895 240 Box (240 Lots x 1 Cassette)

M5-117-492 Pre-sized Label Cartridges for Printers

Sign In for Pricing
View Details
Gpr119 (NM_181770) Rat Tagged Lenti ORF Clone
RR205502L3 10 µg

Gpr119 (NM_181770) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Fbxw14 3'UTR GFP Stable Cell Line
TU156449 1.0 mL

Fbxw14 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ID4 Antibody
MBS9604645-01 0.1 mL

ID4 Antibody

Sign In for Pricing
View Details
ID4 Antibody
MBS9604645-02 0.2 mL

ID4 Antibody

Sign In for Pricing
View Details