Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX6 Rabbit Polyclonal Antibody (HRP)

DDX6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P54, RCK, HLR2, IDDILF, Rck/p54

UniProt

P26196

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DDX6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004388

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VCP Mouse Monoclonal Antibody [Clone ID: Hs-14]
AM03029FC-N 50 Tests

VCP Mouse Monoclonal Antibody [Clone ID: Hs-14]

Sign In for Pricing
View Details
14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), CF647 conjugate, 0.1mg/mL
BNC472231-500 1x 500 µL

14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RET Human qPCR Primer Pair (NM_020975)
HP233916 200 Reactions

RET Human qPCR Primer Pair (NM_020975)

Sign In for Pricing
View Details
Slc5a9 Mouse Gene Knockout Kit (CRISPR)
KN516166 1 Kit

Slc5a9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARID2 Rabbit Polyclonal Antibody
TA371215 100 µL

ARID2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD63 (LAMP3/968), CF488A conjugate, 0.1mg/mL
BNC880968-500 1x 500 µL

CD63 (LAMP3/968), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details