Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX6 Rabbit Polyclonal Antibody (HRP)

DDX6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P54, RCK, HLR2, IDDILF, Rck/p54

UniProt

P26196

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DDX6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004388

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RBM22 activation kit by CRISPRa
GA110890 1 Kit

Human RBM22 activation kit by CRISPRa

Sign In for Pricing
View Details
SENP1 Rabbit Polyclonal Antibody
TA385226 100 µL

SENP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ELAVL4 (NM_001144777) Human Over-expression Lysate
LC428517 20 µg

ELAVL4 (NM_001144777) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS706400 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Aspartate beta hydroxylase (ASPH) (NM_001164752) Human Over-expression Lysate
LC431238 20 µg

Aspartate beta hydroxylase (ASPH) (NM_001164752) Human Over-expression Lysate

Sign In for Pricing
View Details
Ultra Low Retention tip BPIC-411
BPIC-411 1 Unit

Ultra Low Retention tip BPIC-411

Sign In for Pricing
View Details