Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX10 Rabbit Polyclonal Antibody (HRP)

DDX10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dbp4, HRH-J8

UniProt

Q13206

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence EEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSEDMENKISDTKKK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSEDMENKISDTKKK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

101 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

NCBI Accession Number

NP_004389

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Prostate
CB526055 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Recombinant GABA A Receptor beta 2 Antibody
RC-15819-01 50 μL

Recombinant GABA A Receptor beta 2 Antibody

Sign In for Pricing
View Details
Recombinant GABA A Receptor beta 2 Antibody
RC-15819-02 100 µL

Recombinant GABA A Receptor beta 2 Antibody

Sign In for Pricing
View Details
Recombinant GABA A Receptor beta 2 Antibody
RC-15819-03 1 mL

Recombinant GABA A Receptor beta 2 Antibody

Sign In for Pricing
View Details
LRRC52 (NM_001005214) Human Over-expression Lysate
LY423806 100 µg

LRRC52 (NM_001005214) Human Over-expression Lysate

Sign In for Pricing
View Details
2-[2-[2-[2-[4-(Dibenzo[b,f][1,4]thiazepin-11-yl)piperazin-1-yl]ethoxy]ethoxy]ethoxy]ethanol Dihydrochloride
TRC-D418686-10MG 10 mg

2-[2-[2-[2-[4-(Dibenzo[b,f][1,4]thiazepin-11-yl)piperazin-1-yl]ethoxy]ethoxy]ethoxy]ethanol Dihydrochloride

Sign In for Pricing
View Details