Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX10 Rabbit Polyclonal Antibody (Biotin)

DDX10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Dbp4, HRH-J8

UniProt

Q13206

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence EEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSEDMENKISDTKKK

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSEDMENKISDTKKK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

101 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

NCBI Accession Number

NP_004389

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RUVBL2 Peptide
orb2020819 100 µg

RUVBL2 Peptide

Sign In for Pricing
View Details
Porcine Cardiac Conducting Tissue Antibodies ELISA Kit
MBS7260808-01 48 Well

Porcine Cardiac Conducting Tissue Antibodies ELISA Kit

Sign In for Pricing
View Details
Porcine Cardiac Conducting Tissue Antibodies ELISA Kit
MBS7260808-02 96 Well

Porcine Cardiac Conducting Tissue Antibodies ELISA Kit

Sign In for Pricing
View Details
Porcine Cardiac Conducting Tissue Antibodies ELISA Kit
MBS7260808-03 5x 96 Well

Porcine Cardiac Conducting Tissue Antibodies ELISA Kit

Sign In for Pricing
View Details
Porcine Cardiac Conducting Tissue Antibodies ELISA Kit
MBS7260808-04 10x 96 Well

Porcine Cardiac Conducting Tissue Antibodies ELISA Kit

Sign In for Pricing
View Details
ALDH9A1 Antibody - C-terminal region : FITC (ARP74380_P050-FITC)
ARP74380_P050-FITC 100 µL

ALDH9A1 Antibody - C-terminal region : FITC (ARP74380_P050-FITC)

Sign In for Pricing
View Details