Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX10 Rabbit Polyclonal Antibody (Biotin)

DDX10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Dbp4, HRH-J8

UniProt

Q13206

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence EEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSEDMENKISDTKKK

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EEAFLDWSDDDDDDDDGFDPSTLPDPDKYRSSEDSDSEDMENKISDTKKK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

101 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

NCBI Accession Number

NP_004389

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT33A Antibody
E40PV2067 50 µL

KRT33A Antibody

Sign In for Pricing
View Details
USP9YP33 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV755517 1.0 µg DNA

USP9YP33 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
RYBP antibody - N-terminal region (ARP38972_P050)
ARP38972_P050 100 µL

RYBP antibody - N-terminal region (ARP38972_P050)

Sign In for Pricing
View Details
MUC1 (Mucin-1, MUC-1, Breast Carcinoma-associated Antigen DF3, Cancer Antigen 15-3, CA 15-3, Carcinoma-associated Mucin, Episialin, H23AG, Krebs von den Lungen-6, KL-6, PEMT, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, Tumor-ass
MBS6401317-01 0.1 mL

MUC1 (Mucin-1, MUC-1, Breast Carcinoma-associated Antigen DF3, Cancer Antigen 15-3, CA 15-3, Carcinoma-associated Mucin, Episialin, H23AG, Krebs von den Lungen-6, KL-6, PEMT, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, Tumor-ass

Sign In for Pricing
View Details
MUC1 (Mucin-1, MUC-1, Breast Carcinoma-associated Antigen DF3, Cancer Antigen 15-3, CA 15-3, Carcinoma-associated Mucin, Episialin, H23AG, Krebs von den Lungen-6, KL-6, PEMT, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, Tumor-ass
MBS6401317-02 5x 0.1 mL

MUC1 (Mucin-1, MUC-1, Breast Carcinoma-associated Antigen DF3, Cancer Antigen 15-3, CA 15-3, Carcinoma-associated Mucin, Episialin, H23AG, Krebs von den Lungen-6, KL-6, PEMT, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, Tumor-ass

Sign In for Pricing
View Details
(8-Boc-5,6,7,8-Tetrahydro-[1,8]naphthyridin-2-yl) -acetic acid methyl ester
sc-268430 10 mg

(8-Boc-5,6,7,8-Tetrahydro-[1,8]naphthyridin-2-yl) -acetic acid methyl ester

Sign In for Pricing
View Details