Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAT1 Rabbit Polyclonal Antibody (Biotin)

BAT1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BAT1, UAP56, D6S81E

UniProt

Q13838

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human BAT1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_542165

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melan-A (D-6) : m-IgG1 BP-HRP Bundle
sc-542252 1 Kit

Melan-A (D-6) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Cytokeratin 1 Mouse mAb IHC Kit
KV0043-01 3 mL

Cytokeratin 1 Mouse mAb IHC Kit

Sign In for Pricing
View Details
Cytokeratin 1 Mouse mAb IHC Kit
KV0043-02 6 mL

Cytokeratin 1 Mouse mAb IHC Kit

Sign In for Pricing
View Details
Cytokeratin 1 Mouse mAb IHC Kit
KV0043-03 10 mL

Cytokeratin 1 Mouse mAb IHC Kit

Sign In for Pricing
View Details
NE Purified anti-human CD274 (B7-H1, PD-L1)
E16FHY274-500U 500 µg

NE Purified anti-human CD274 (B7-H1, PD-L1)

Sign In for Pricing
View Details
Eif2ak4, CT (Eif2ak4, Gcn2, Kiaa1338, Eukaryotic translation initiation factor 2-alpha kinase 4, GCN2-like protein) (APC)
MBS6294864-01 0.2 mL

Eif2ak4, CT (Eif2ak4, Gcn2, Kiaa1338, Eukaryotic translation initiation factor 2-alpha kinase 4, GCN2-like protein) (APC)

Sign In for Pricing
View Details