Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX23 Rabbit Polyclonal Antibody (Biotin)

DDX23 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Prp28, PRPF28, U5-100K, SNRNP100, U5-100KD

UniProt

Q9BUQ8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DDX23

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004809

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX7A1 Conjugated Antibody
orb1616156 100 µL

COX7A1 Conjugated Antibody

Sign In for Pricing
View Details
ATG4D Rabbit Polyclonal Antibody
orb154870 100 µg

ATG4D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SDF2 Rabbit Polyclonal Antibody (Biotin)
orb2114047 100 µL

SDF2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Vibrio harveyi Crossover junction endodeoxyribonuclease RuvC (ruvC)
MBS1133649-01 0.02 mg (E-Coli)

Recombinant Vibrio harveyi Crossover junction endodeoxyribonuclease RuvC (ruvC)

Sign In for Pricing
View Details
Recombinant Vibrio harveyi Crossover junction endodeoxyribonuclease RuvC (ruvC)
MBS1133649-02 0.1 mg (E-Coli)

Recombinant Vibrio harveyi Crossover junction endodeoxyribonuclease RuvC (ruvC)

Sign In for Pricing
View Details
Recombinant Vibrio harveyi Crossover junction endodeoxyribonuclease RuvC (ruvC)
MBS1133649-03 0.02 mg (Yeast)

Recombinant Vibrio harveyi Crossover junction endodeoxyribonuclease RuvC (ruvC)

Sign In for Pricing
View Details