Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX23 Rabbit Polyclonal Antibody (HRP)

DDX23 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Prp28, PRPF28, U5-100K, SNRNP100, U5-100KD

UniProt

Q9BUQ8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004809

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2RY10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV631311 1.0 µg DNA

P2RY10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Olfr1234 activation kit by CRISPRa
GA215800 1 Kit

Mouse Olfr1234 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse PDGFD Protein, N-His
orb2824273-01 20 µg

Recombinant Mouse PDGFD Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse PDGFD Protein, N-His
orb2824273-02 50 µg

Recombinant Mouse PDGFD Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse PDGFD Protein, N-His
orb2824273-03 100 µg

Recombinant Mouse PDGFD Protein, N-His

Sign In for Pricing
View Details
Recombinant Bat coronavirus HKU3 Nucleoprotein2 (N)
orb1096621-01 20 µg

Recombinant Bat coronavirus HKU3 Nucleoprotein2 (N)

Sign In for Pricing
View Details